Lot 121 Zone Industrielle Route de Tetouan Tanger Maroc Tel: + 212 (0)39 953269 Alt: + 212 (0)39 953281 Fax: + 212 (0)39 953290 Email: maroc@jbsewing.com
011 49-2571- 953269 Email: fritz@poelking.com Website: http://www.poelking.com ... Hong Kong, fax +00-852-28816979), Peter Arnold (NY, fax 212 ...
19.06.2008 ??????? "??????????" ?? 19.06.2008 ... 212 | ??????????: 0 | ???????: 0
... ref|YP_001012380.1| predicted Iron dependent r... 71 3e-11 gi|120403440|ref|YP_ 953269.1| ... Identities = 123/ 212 (58%), Positives = 159/ 212 (75%) Query: 1 ...
... http://13358.spreadshirt.com/us/US/Shop/Article/Index/article/Gaelic-Traditionalist-1046581" target="_blank">
gagcccatggcaagttggcccaccgatcggtttggtacca 17 89 0 catgcaccgg 0.954237 - 212 ... aggtgccagcagaactgcaacacgtttcagt 15 40 0 agaactgcac 0. 953269 -64 ...
... ref|ZP_01855395.1| iron-dependent transcriptio... 77 1e-12 gi|120403440|ref|YP_ 953269.1| ... G F Sbjct: 153 RFDPHGDPIPTREGRWPGAEGRALLAWNPGVSGVIEHIEDEPPSLFARLAQDGIYAGMRF 212 Query ...
... 0.008 ref|YP_677977.1| transcriptional regulator [Cytophaga hutch... 42 0.008 gb|EAG27090.1| unknown [environmental sequence] 42 0.010 ref|YP_ 953269.1| iron ...
6/3/2004: 19: 2.705: 2.51565: 8.78: 1. 953269: 1.134704: 6/3/2004: 20: 2.478: 2.30454: 0.46: 1.896843: 1.007057: 6/3/2004: 21: 2.265: 2.10645-7.55: 1.843898: 1: 6/3/2004: 22: 2.171: 2.01903-13.61: 1.820532: 1
... COMMON 780259107 522 6259 SH SOLE 6259 SCHERING-PLOUGH CORP COMMON 806605101 29018 953269 ... Dean Ph: 1 ( 212) 704-8196 / 704-4484 meaghan.smith@edelman.com noelle.dean@edelman.com 1 ...
... 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 ... Bild-Nr. Hersteller: 953269
... 3e-54 ref|ZP_01325606.1| hypothetical protein BpseP_03000398 [Bur... 212 5e-54 ref|YP ... MWYL1] >gi... 87 4e-16 ref|NP_ 953269.1| chemotaxis protein CheW [Geobacter sulfurr... 87 ...
... 0.652069: 0.628483: 0.639651: 0.665009: 0.667550: 1.136156: 1.220999: 1.260580: 1.230758: 1.173060: 1.303302: 1.121347: 1.047695: 0.962619: 1.100028: 1.366 212: 1.533375: 1.426728: 1.532596: 1.295728: 1.164617: 0. 953269
244.000 212.000. 21696094.244 -489676.63649 -365965.24547 21696094.017 21696101.561. 239.000 201.000. 22198593.504 -679269.97149 ...
... 212 102 > < 214 103 > 104 > < 242 105 > 106 > 107 a > 215 > ... CF-EC1-abp-c-22 BM972579 UI-CF-EC1-abp-494 1072 UI-CF-EC1 188 GB nh24b07.s1 AA578784 953269 ...
... 212 > < 998 213 > < 999 214 > < 1000 215 > < ... ceres-148 246 i034 956696 dr251311 153024 146 595 ceres-148 247 i034 953269 ...
UTC - hours,minutes,seconds,latitude,longitude,altitude (m),altitude (ft),GPS Status,hdop/pdop,visible sats,tracked sats,2D Speed (MPH),3D Speed (MPH),heading,bus voltage,ref ...
v -0. 953269 -0.217598 6.44372. v -0.417055 -0.396337 10.0185. v -0.297895 -0.158019 10.7334 ... f 179/211 195/ 212 194/213. f 190/214 165/182 166/181. usemtl Material__1. f 177/193 185/201 ...
20.3180000 4.00000000 .145000000 .035500000 .109500000 0.0 4325 2151 212. 5.58440000 5.00000000 .143237300 .003283727 .140000000 0.0 4325 2151 213
exp 0 /net/volcano/u02/nsdi/nsdihome/browse/monroe/wells.e00 . lab 2. 13300007 0 2.7849230e+06 2.0000870e+06. 2.7849230e+06 2.0000870e+06 2.7849230e+06 2 ...
f 202/2/214 203/2/213 204/2/ 212. f 202/2/214 205/2/215 203/2/213. f 206/2/217 207/2/216 186/2/194. f 206/2/217 208/2/218 207/2/216. f 209/2/219 185/2/195 190/2/198
Seal of Approval, Version E # 6497 verticies and 7049 polygons input # 6497 verticies and 7049 polygons output to new file # 33 Groups and 12 Smoothing groups with 4 materials
620111475 110.873977 .682067211 105. 953269 .743102694 101.7 212026528 3 1 136. ... 55423.1098 11.4117337 58541.1829 11.1549382 60803.5120 10.96891166528 3 1 212
212 22.824717 29.390606 4.598057 -3.850849. 213 22.354374 28 ... 1490 22.061577 31.637 212 5. 953269 -1.637757. 1491 20.955269 30.607896 ...
For the period between 01/Oct/2005:08:00:36 and 01/Nov/2005:07:39:52 WWW server SERVUS server TOTAL COUNT ...
... 13621 Aix-en-Provence cedex 1, France (tel. **/33/0442/953293, fax **/33/0442/ 953269) E ... America, 365 Fifth Avenue, Room 5400 New York, NY 10016-4309 USA (tel. **/1/ 212 ...
212 26.346879 36.414256 -1.265983 -6.376522. 213 29.632171 35.630683 -1.456487 -5.885241. 214 31.579611 35.980437 -2.919998 -7.343643
... http://www.interconnectcom.com/images/5/blog.php?p4536#1nadausedautovalue, 953269,ahref"http ... 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 ...
212 1087957.8 905033.2 192.9. 213 1087706.1 905305.3 192.5. 214 1087632.7 905707.4 193.5 ... 1776 1076278.4 953269.5 85.1. 1777 1075922.6 953221.3 85.1. 1778 1075562.3 953174.7 88.0
|