elcasilindo_lc10 said on 4/28/08 1:26 PM ? Olaa*oiie me agregas a EFES ,, ii cuando de vea en miis reverses te agregoo yoo! Olaa*oiie me agregas a EFES ,, ii cuando de vea en ...

lau_mes3 said on 5/14/08 5:11 PM ? q fas despullan-te?? Un poquito de por favoooooooooor Ester! jajaj Un petó guarri, fins demà :D

Viewing profile :: reir reir y reir; Avatar: All about reir reir y reir ... E-mail address: Private Message: MSN Messenger: Yahoo Messenger: AIM Address:

Viewing profile :: reir; Avatar: All about reir ... E-mail address: Private Message: MSN Messenger: Yahoo Messenger: AIM Address:

... to die servir (e > i > i) to serve pedir (e > i > i) to ask, request: 2 sonreír (e > i > i) to smile preferir (e > ie > i) to prefer vestir (e > i > i) to clothe, dress: 2 reír (e > i ...

Is é "réir" an tuiseal tabhartach den fhocal riar. "M'a réir", ciallaíonn sé "saor"; agus "riaraichte", ciallaíonn sé sona sásta. Tá "reir-chearc" san fhoclóir mar ...

Viewing profile :: REIR*** Avatar: All about REIR*** Novice ... E-mail address: Private Message: MSN Messenger: Yahoo Messenger: AIM Address:

I'm a very busy woman, pero me gusta divertirme cuando tengo tiempo...Me encanta reir e ir a los comedy clubs. My Ideal Person: Someone who is honest, que le guste divertirse e reir.

Examples: off e ndeir (to offend): off e ndo; qu e reir (to look for): qu e ro; tz e neir (to hold): tz e nho; x e deir (to sit): x e dzo. Note that when the of the ...

The rules assign stress on diphthongs and hiatuses and consequently produce correct transcription of the closed vowels ('rehfiye' [rr e "ujj e], 'reir' [rr e "i r], 'oir' [o "i r]) c ...

reír: e-i-ío: rí-3 rd e-i: to laugh : rendir: e-i: rind-3 rd e-i: to render, conquer, subdue ...

reír: e-i-ío: rí-to laugh: relacionar: relacion-to relate, report, narrate, state, enumerate: relajar: relaj-to relax

reír (e-i) to laugh: reñir (e-i) to argue: repetir (e-i) to repeat: servir (e-i) to serve: sonreír (e-i) to smile: seguir (e-i) to follow: conseguir (e-i) to get

... grepg-ckvq d vyvnvh-----k v s l p rwkqrrkaspelaliwdtllqd i rrhee s hiv i arshasem e reir s l a slrad i dkvtsrvmeahdeaqqy d l vetinfenrferl l t y rlermrq. 190

... 180 190 200 210 220 230 240....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....| local 515 AQLN r L K K LA I EKSDP ltlt E REIR R ...

... query: 180 -elprdaydvtvdwiatteglmqsvgaiekptgivwsevteeeleampvlreirel 234 # e+p + +dv vd i t g + v ekp g++ + e+ +reir l # sbjct: 180 ...

... e::ri.n:i :r.a!-*: cha! rh. p.rs.r fo1 r.h.n y.ir ;:e!,.arrir.:1E 1! r: rlre uiit.c si:a.es an{i ?r11 appiy a.! adjrsl:renr ct s!:a:!r !e o. she.si6!11 coif.acr--!E tcca: rris,-rEir.e to ...

25. ?(1) Beidh teideal ag duine, faoi réir é do chomhlíonadh na gcoinníollacha ordaithe, chun pé sochair chóireála a sonrófar le rialacháin.

... más iomchuí, comhaontuithe a dhéanamh le comhlachtaí dá samhail lasmuigh den Stát, faoi réir thoiliú an Aire agus an Aire Airgeadais agus, más iomchuí, faoi réir é do ...

... had prior to its extraction or isolation, c) a vitamin, (a term which is defined in the Regulations) or any of its salts or derivatives, d) an amino acid or any of its salts, e) an ...

reír (e-i) To laugh: escuchar: To listen: recomendar: To recommend: alquilar: To rent: descansar: To rest: correr: To run: ver: To see: dormir (o-ue) To sleep: probar (o-ue) To try

xteam @ 06-25-2008 said: ajajjaa che bembon XD chida la pic ajajaja si ta mamon lo del mamut ¬¬ pero a poco no te hise reir :E ajajaja ahi te ves bro

un video medio raro pero noc si les hace reir e... ... un video medio raro pero noc si les hace reir en buena hora...

2.1 ~ Ach admhaíonn an Stát gur cuí, sa chomhdhaonnacht shibhialta, oibriú na gceart atá luaite sna forálacha sin romhainn den Airteagal seo a rialú d e réir bunrialacha an ...

2) Le linn na nea-láithreachta no an mhí-chumais gur mar gheall air a ceapfar é, ach fé réir é do leanúint de bheith ina bhall den Choiste, beidh ag gach Leas-Chathaoirleach ...

faoi réir é d ' íoc as de réir an ráta a bheidh de thuras na huaire inéilithe de réir dlí = subject to payment therefor at the rate for the time being chargeable by law;

Bhiodh e math gu tràladh na van dhaibh. Ged leigeadh iad mu rèir e, Bheireadh e e-fhèin às Ged tha e gun Bheurla, gun Fhrangais. Air ais

... cibé acu is Príomh-Oifigeach nó eile a thabharfar de thuairisc ar an oifigeach sin) fostaithe amhlaidh fós díreach roimh thosach feidhme an Achta seo, ansin, faoi réir é ...

Indogermanisches Etymologisches Woerterbuch [Pokorny] : New query Record number: 1606. Root / lemma: rei-r(e:i)- English meaning: to tremble (expr. ) German meaning: `beben ...

Norsk Ornitologisk Forening - Sandgata 30 B, 7012 Trondheim - Tlf. 73 84 16 40 - E-post: nof@birdlife.no